Streptomyces changanensis: NRO40_22775 Help Entry NRO40_22775       CDS       T09753                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism schg  Streptomyces changanensis Pathway schg00261   Monobactam biosynthesis schg01100   Metabolic pathways schg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:schg00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     NRO40_22775  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:schg01008]     NRO40_22775 Polyketide biosynthesis proteins [BR:schg01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     NRO40_22775 BRITE hierarchy Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  UUS33353 LinkDB All DBs Position complement(5143062..5143232) Genome browser AA seq 56 aa AA seqDB search MTNPFDSEDRMYAVLRNDRAEHSLWPVGIEVPDGWTVVHEEDSRASCLTWIEAHAS NT seq 171 nt NT seq  +upstreamnt  +downstreamnt atgaccaaccccttcgacagcgaggaccgcatgtacgccgtcctccgcaacgaccgcgcc gagcactccctgtggccggtcggcatcgaggtcccggacggctggacggtcgtccacgag gaggactcccgcgcgtcctgcctcacctggatcgaggcacacgcgtcctga

DBGET integrated database retrieval system