Streptomyces collinus: B446_23780 Help Entry B446_23780        CDS       T02787                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism sci  Streptomyces collinus Pathway sci00261   Monobactam biosynthesis sci01100   Metabolic pathways sci01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sci00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     B446_23780  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sci01008]     B446_23780 Polyketide biosynthesis proteins [BR:sci01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     B446_23780 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AGS71568 UniProt:  S5UWG5 LinkDB All DBs Position 5452379..5452603 Genome browser AA seq 74 aa AA seqDB search MAEQKTDEAVYRVVLNDEEQYSIWWADRPLPAGWHAEGTEGSREDCLARIDSVWTDMRPL SLRLRMAETGPTAA NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggccgaacagaagaccgacgaggccgtgtaccgcgtggtgctcaacgacgaggagcag tactcgatctggtgggccgaccgtccgctgccggccggctggcacgccgagggcaccgag ggctcccgcgaggactgcctggcgcggatcgactccgtgtggaccgacatgcgcccgctg agcctgcgcctgcggatggcggagaccggccccacggcggcctga

DBGET integrated database retrieval system