Streptomyces cinereoruber: CP977_02435 Help Entry CP977_02435       CDS       T07115                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism scin  Streptomyces cinereoruber Pathway scin00261   Monobactam biosynthesis scin01100   Metabolic pathways scin01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scin00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CP977_02435  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:scin01008]     CP977_02435 Polyketide biosynthesis proteins [BR:scin01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CP977_02435 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QEV31166 UniProt:  A0A5J6IFI8 LinkDB All DBs Position complement(537249..537467) Genome browser AA seq 72 aa AA seqDB search MSNPFDDESGRFVVLVNGEAQYSLWPAHLDVPGGWDREGTEGSRQECLERIENVWTDMRP AGLVAAMEAEAG NT seq 219 nt NT seq  +upstreamnt  +downstreamnt gtgagcaatcccttcgatgacgagtcggggcgcttcgtcgtgctggtgaacggcgaagcc cagtactccctctggcccgcgcatctggacgttcccggcggctgggaccgcgaggggacc gaagggtcgcgccaggagtgtctggagcggatcgagaacgtctggaccgacatgcgtccc gccggactggtggcggcgatggaggccgaagccggctga

DBGET integrated database retrieval system