Streptomyces cinereoruber: CP977_04015 Help Entry CP977_04015       CDS       T07115                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism scin  Streptomyces cinereoruber Pathway scin00261   Monobactam biosynthesis scin01100   Metabolic pathways scin01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scin00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CP977_04015  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:scin01008]     CP977_04015 Polyketide biosynthesis proteins [BR:scin01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CP977_04015 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QEV31434 UniProt:  A0A5J6IJD9 LinkDB All DBs Position 913159..913368 Genome browser AA seq 69 aa AA seqDB search MTATNPFEDDDARYYVLVNAENQHSLWPAFAEVPDGWTVVHGEDSRQGCAAYTEEHWTDL RPASLAARS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgaccgcgaccaaccccttcgaggacgacgacgcccgctactacgtgctcgtcaacgcc gagaaccagcactcgctctggccggccttcgccgaggtgccggacggctggaccgtggtg cacggcgaggactcccggcagggctgcgccgcgtacaccgaggagcactggacggacctg cgtccggcgagcctcgccgcccgttcctga

DBGET integrated database retrieval system