Streptomyces cinnabarinus: STRCI_000345 Help Entry STRCI_000345      CDS       T08957                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism scir  Streptomyces cinnabarinus Pathway scir00261   Monobactam biosynthesis scir01100   Metabolic pathways scir01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scir00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     STRCI_000345  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:scir01008]     STRCI_000345 Polyketide biosynthesis proteins [BR:scir01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     STRCI_000345 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WAZ19305 LinkDB All DBs Position 371461..371640 Genome browser AA seq 59 aa AA seqDB search MTGPFDPGPEDRATHLVLENAAGQLSLWPVWRAVPAGWTTGFGPASHADCARRVEAAEG NT seq 180 nt NT seq  +upstreamnt  +downstreamnt atgaccggtcccttcgatcccggacccgaggaccgggcgacccacctggtgctggagaac gcggccggacagctgtcgctgtggcccgtctggcgtgccgtccccgccggctggaccacg ggcttcgggcccgcctcgcacgcggactgtgcgcgacgagtcgaggcggccgagggatga

DBGET integrated database retrieval system