Streptomyces cinnabarinus: STRCI_000965 Help Entry STRCI_000965      CDS       T08957                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism scir  Streptomyces cinnabarinus Pathway scir00261   Monobactam biosynthesis scir01100   Metabolic pathways scir01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scir00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     STRCI_000965  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:scir01008]     STRCI_000965 Polyketide biosynthesis proteins [BR:scir01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     STRCI_000965 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WAZ19882 LinkDB All DBs Position complement(1031112..1031321) Genome browser AA seq 69 aa AA seqDB search MSNPFEDPEGVYLVLVNDENQHSLWPDFADVPAGWRVVHGPAARQSCLEYVETHWTDMRP RSLAEAMDN NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgagcaacccgttcgaggaccccgagggcgtctacctggtgctcgtcaacgacgagaac cagcacagcctctggccggacttcgccgacgtcccggccggctggcgggtggtccacggc ccggcggcgcggcagtcctgcctggagtacgtcgagacccactggaccgacatgcggccc cgcagcctggccgaggccatggacaactga

DBGET integrated database retrieval system