Streptomyces cinnabarinus: STRCI_001048 Help Entry STRCI_001048      CDS       T08957                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism scir  Streptomyces cinnabarinus Pathway scir00261   Monobactam biosynthesis scir01100   Metabolic pathways scir01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scir00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     STRCI_001048  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:scir01008]     STRCI_001048 Polyketide biosynthesis proteins [BR:scir01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     STRCI_001048 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WAZ19960 LinkDB All DBs Position complement(1152006..1152224) Genome browser AA seq 72 aa AA seqDB search MPNPFENENGQYLVLANDEDQHSLWPAQIAVPAGWRTVHGVDSRAACLEYIETHWTDIRP ASLRRAMDRMAG NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgccgaaccccttcgagaacgagaacggacagtacctggtcctcgccaacgacgaggac cagcactcgctgtggcccgcccagatcgccgtaccggccggctggcgcaccgtccacggt gtcgacagccgcgccgcgtgcctggagtacatcgagacccactggaccgacatccgcccg gcgagcctgcgccgggccatggaccggatggccggctga

DBGET integrated database retrieval system