Sorangium cellulosum So ce56: sce7109 Help Entry sce7109           CDS       T00634                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism scl  Sorangium cellulosum So ce56 Pathway scl00261   Monobactam biosynthesis scl01100   Metabolic pathways scl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scl00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     sce7109  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:scl01008]     sce7109 Polyketide biosynthesis proteins [BR:scl01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     sce7109 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  CAN97278 UniProt:  A9ERB2 LinkDB All DBs Position complement(9909042..9909281) Genome browser AA seq 79 aa AA seqDB search MNQEERQDAATYRVVVDHEKQYTVCPVERAIPSGSREAGKQGSIMECLAYIEQAWERLRA PEEGCAPAEVARARAEWLS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgaaccaggaagagcggcaggacgcagccacctatcgcgtcgtcgtcgatcacgagaag cagtacaccgtctgccctgtcgagcgcgcgatcccgagcgggtcgcgggaggccggcaag cagggatccatcatggagtgcctcgcttatatcgagcaggcatgggagcgcctgcgcgcc ccggaggagggatgcgccccggcggaggtcgcccgagcgcgcgcggagtggctctcctga

DBGET integrated database retrieval system