Streptomyces clavuligerus: BB341_02115 Help Entry BB341_02115       CDS       T04717                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism sclf  Streptomyces clavuligerus Pathway sclf00261   Monobactam biosynthesis sclf01100   Metabolic pathways sclf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sclf00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BB341_02115  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sclf01008]     BB341_02115 Polyketide biosynthesis proteins [BR:sclf01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BB341_02115 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ANW17098 LinkDB All DBs Position complement(551513..551743) Genome browser AA seq 76 aa AA seqDB search MTHPWDDSEATFLVLVNSEGQHSLWPSRTAVPAGWTTVCGPAAHQLCVAYVDEHWTDMRP KSLIDHHDRYAKEGSR NT seq 231 nt NT seq  +upstreamnt  +downstreamnt gtgacccatccctgggacgacagcgaggccaccttcctcgtcctcgtcaacagcgaggga cagcacagcctgtggccctcccgcaccgcggtccccgcggggtggaccaccgtctgcgga cccgcggcccatcagctctgcgtcgcctacgtcgacgagcactggaccgacatgcgcccc aagagcctcatcgaccaccacgaccgttacgcgaaggaggggtcccggtga

DBGET integrated database retrieval system