Streptomyces coelicolor: SCO0489 Help Entry SCO0489           CDS       T00085                                  Symbol SCF34.08c Name (RefSeq) hypothetical protein   KO K05375   MbtH protein Organism sco  Streptomyces coelicolor Pathway sco00261   Monobactam biosynthesis sco01100   Metabolic pathways sco01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sco00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SCO0489 (SCF34.08c)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sco01008]     SCO0489 (SCF34.08c) Polyketide biosynthesis proteins [BR:sco01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SCO0489 (SCF34.08c) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-GeneID:  1095912 Kitasato:  SCO0489 LinkDB All DBs Position complement(510823..511035) Genome browser AA seq 70 aa AA seqDB search MSTNPFDDADGRFLVLVNDEGQHSLWPAFAAVPGGWTTVFEENTRDACLAYVEANWTDLR PRSLARTADA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaaccccttcgacgacgccgacggccgctttctggtcctggtgaacgacgag ggccagcactcgctctggccggccttcgcggcggtgccgggcggatggacgaccgtgttc gaggagaacacccgggacgcctgcctggcctacgtcgaggccaactggaccgacctgcgc ccacgttccctcgcccggaccgcggacgcctga

DBGET integrated database retrieval system