Streptomyces coralus: QU709_19890 Help Entry QU709_19890       CDS       T09650                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism scoa  Streptomyces coralus Pathway scoa00261   Monobactam biosynthesis scoa01100   Metabolic pathways scoa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scoa00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     QU709_19890  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:scoa01008]     QU709_19890 Polyketide biosynthesis proteins [BR:scoa01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     QU709_19890 BRITE hierarchy Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WLW53493 LinkDB All DBs Position complement(4487553..4487771) Genome browser AA seq 72 aa AA seqDB search MSSNPFEDPEGTYLVVVNDEGQHSLWPAFVEVPAGWRTALGETTRDAALEYVNTHWTDMR PKSLVDAMDGTA NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgagcagcaatcccttcgaggaccccgagggcacctacctggtcgtcgtcaacgacgag gggcagcactcgctgtggccggcgttcgtcgaggtgcccgccggctggcggaccgccctc ggggagaccacccgcgacgcggcgctcgagtacgtcaacacgcactggaccgacatgcgt cccaagagcctcgtcgacgccatggacggcaccgcctga

DBGET integrated database retrieval system