Streptomyces coeruleorubidus: CP976_37700 Help Entry CP976_37700       CDS       T07302                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism scoe  Streptomyces coeruleorubidus Pathway scoe00261   Monobactam biosynthesis scoe01100   Metabolic pathways scoe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scoe00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CP976_37700  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:scoe01008]     CP976_37700 Polyketide biosynthesis proteins [BR:scoe01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CP976_37700 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QEV29291 UniProt:  A0A5J6IE18 LinkDB All DBs Position 8211122..8211334 Genome browser AA seq 70 aa AA seqDB search MSTNPFDDADGRFLVLVNDEGQHSLWPSFADVPGGWTIAFEENTREACLQYVEANWTDMR PRSLAESMDA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaaccccttcgacgacgccgacggccgtttcctcgtcctcgtgaacgacgag ggccagcactcgctctggccgtccttcgcggatgtgcccgggggctggaccatcgccttc gaggagaacacccgggaggcctgcctgcagtacgtcgaggccaactggaccgatatgcgc ccccgttccctcgccgagtccatggacgcctga

DBGET integrated database retrieval system