Sorangium cellulosum So0157-2: SCE1572_48210 Help Entry SCE1572_48210     CDS       T02718                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism scu  Sorangium cellulosum So0157-2 Pathway scu00261   Monobactam biosynthesis scu01100   Metabolic pathways scu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scu00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SCE1572_48210  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:scu01008]     SCE1572_48210 Polyketide biosynthesis proteins [BR:scu01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SCE1572_48210 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AGP41605 UniProt:  S4YB92 LinkDB All DBs Position complement(13540923..13541150) Genome browser AA seq 75 aa AA seqDB search MASEEHEDNTIYKVVVNHEEQYSIWPEYRENPLGWRDAGKAGTKAECLDHIKEVWTDMRP LSLRKQMDAQEGRSS NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggccagcgaagagcatgaagacaacaccatttacaaagtcgtcgtgaaccacgaggag cagtactcgatatggcccgagtaccgggaaaacccgctcggatggcgcgacgcgggcaag gccggcaccaaggcggagtgcctcgatcacatcaaggaggtctggaccgacatgcggccg ctcagcctgcgcaagcagatggacgcgcaggagggccggtcgtcgtga

DBGET integrated database retrieval system