Streptomyces cyaneogriseus: TU94_03210 Help Entry TU94_03210        CDS       T03687                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism scw  Streptomyces cyaneogriseus Pathway scw00261   Monobactam biosynthesis scw01100   Metabolic pathways scw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scw00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     TU94_03210  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:scw01008]     TU94_03210 Polyketide biosynthesis proteins [BR:scw01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     TU94_03210 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AJP00659 UniProt:  A0A0C5FXT3 LinkDB All DBs Position complement(895721..895975) Genome browser AA seq 84 aa AA seqDB search MTPKPGDDDRPYEAVVGHEEQYSLRPPDRDTPAGRSEAGGTGPRSDCPAHTEEMRTDTRP LSPRHRLQAGGQPAPAAPDTGGTG NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgacgccgaagcccggcgatgacgaccggccgtacgaggccgtggtcggccacgaggag cagtactccctccggccccccgaccgggacaccccggccggcaggtcggaggcgggcggc accggccccagaagcgactgccccgcccacaccgaggagatgcggaccgacacgcgcccg ctgagtccgcgccaccgcctccaggcgggcgggcagcccgcaccggccgcaccggacacc ggcggcacgggctga

DBGET integrated database retrieval system