Streptomyces cyaneochromogenes: EJ357_01715 Help Entry EJ357_01715       CDS       T06811                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism scya  Streptomyces cyaneochromogenes Pathway scya00261   Monobactam biosynthesis scya01100   Metabolic pathways scya01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scya00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     EJ357_01715  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:scya01008]     EJ357_01715 Polyketide biosynthesis proteins [BR:scya01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     EJ357_01715 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AZQ32329 UniProt:  A0A3S9LZI8 LinkDB All DBs Position complement(433942..434157) Genome browser AA seq 71 aa AA seqDB search MTNPFDNENGTFLVLVNDEGQHSLWPVFAEIPQGWTTAFGEASRAECLEFVEQHWTDMRP KSLIARTEGAA NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgacgaatcccttcgacaacgagaacggcactttcctggtgctggtcaacgacgagggc cagcactcgctctggccggttttcgcggagattccgcagggctggacgaccgctttcggc gaggcgagccgggccgaatgcctggaattcgtcgagcagcactggaccgacatgcggccc aagagcctcatcgcccgcacggaaggcgccgcgtga

DBGET integrated database retrieval system