Streptomyces cyaneochromogenes: EJ357_24595 Help Entry EJ357_24595       CDS       T06811                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism scya  Streptomyces cyaneochromogenes Pathway scya00261   Monobactam biosynthesis scya01100   Metabolic pathways scya01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scya00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     EJ357_24595  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:scya01008]     EJ357_24595 Polyketide biosynthesis proteins [BR:scya01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     EJ357_24595 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DUF6758 Motif Other DBs NCBI-ProteinID:  AZQ36250 UniProt:  A0A3Q9EV68 LinkDB All DBs Position complement(5414905..5415090) Genome browser AA seq 61 aa AA seqDB search MPEQNTLRHLVVVNHEEQYSVWPATLPLPAGWRATGFEGSREEALAHIGTVWTDLRPLSL R NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atgcctgagcagaacaccctccgtcacctcgtggtcgtcaaccacgaggagcagtactcg gtgtggcccgccacgctgcccctgcccgccggctggcgcgccaccgggttcgagggcagc cgcgaggaggctctcgcgcacatcggcacggtctggaccgacctgcgcccgctcagcctg cgctga

DBGET integrated database retrieval system