Streptomyces cyaneofuscatus: R2B67_01235 Help Entry R2B67_01235       CDS       T09646                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism scye  Streptomyces cyaneofuscatus Pathway scye00261   Monobactam biosynthesis scye01100   Metabolic pathways scye01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scye00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     R2B67_01235  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:scye01008]     R2B67_01235 Polyketide biosynthesis proteins [BR:scye01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     R2B67_01235 BRITE hierarchy Motif Pfam:  MbtH DUF2278 Motif Other DBs NCBI-ProteinID:  WOP07237 LinkDB All DBs Position complement(318513..318731) Genome browser AA seq 72 aa AA seqDB search MTNPFEDENGTYLVLVNDEGQHSLWPSFAEVPAGWTVAHPEDTRQACLDYVEQNWTDLRP KSLIESMAADPT NT seq 219 nt NT seq  +upstreamnt  +downstreamnt gtgaccaacccgttcgaggacgagaacggcacctacctggtgctcgtcaacgacgagggg cagcactccctgtggccctccttcgccgaggtgcccgccggctggaccgtggcccacccg gaggacacccgccaggcctgcctcgactacgtggagcagaactggaccgacctgcggccc aagagcctgatagagagcatggcggccgatccgacatga

DBGET integrated database retrieval system