Streptomyces cyanogenus: S1361_05235 Help Entry S1361_05235       CDS       T07416                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism scyg  Streptomyces cyanogenus Pathway scyg00261   Monobactam biosynthesis scyg01100   Metabolic pathways scyg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scyg00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     S1361_05235  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:scyg01008]     S1361_05235 Polyketide biosynthesis proteins [BR:scyg01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     S1361_05235 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Ribosomal_S19e Motif Other DBs NCBI-ProteinID:  QTD96743 LinkDB All DBs Position complement(1237398..1237616) Genome browser AA seq 72 aa AA seqDB search MTNPFEAPDGTYLVLVNDEGQHSLWPESIEVPDGWTVAKTADTRDACLAYVEENWTDMRP ASLVKAMVAADD NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgacgaacccctttgaggcccccgacggtacctacctcgtactcgtcaacgacgagggc cagcactcgctgtggcccgagtccatcgaggtgccggacggctggaccgtcgccaaaacc gcggacacccgggacgcctgtctcgcctacgtagaggagaactggacggatatgcgtccg gccagcctggtcaaggccatggtcgctgcggacgactga

DBGET integrated database retrieval system