Streptomyces cyanogenus: S1361_29295 Help Entry S1361_29295       CDS       T07416                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism scyg  Streptomyces cyanogenus Pathway scyg00261   Monobactam biosynthesis scyg01100   Metabolic pathways scyg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scyg00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     S1361_29295  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:scyg01008]     S1361_29295 Polyketide biosynthesis proteins [BR:scyg01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     S1361_29295 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DNA_alkylation Motif Other DBs NCBI-ProteinID:  QTE01459 LinkDB All DBs Position 6501978..6502205 Genome browser AA seq 75 aa AA seqDB search MSNPFEGTNSTYFVLVNAEGQYSLWPSTVKIPAGWTTEYGATAKKECVEYIDAHWNDMRP QSLRDAMASLFNPQT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgtcgaacccatttgagggcaccaattctacctacttcgtcttggtaaacgctgagggg caatactccctctggccatcgacggtgaaaatcccagccggatggaccactgagtacggt gccaccgcgaagaaggagtgcgtcgaatacattgacgcacactggaatgacatgcgccct caaagcctgcgcgatgctatggcgagcttgttcaatcctcagacgtga

DBGET integrated database retrieval system