Streptomyces dangxiongensis: D9753_00415 Help Entry D9753_00415       CDS       T08044                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sdd  Streptomyces dangxiongensis Pathway sdd00261   Monobactam biosynthesis sdd01100   Metabolic pathways sdd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sdd00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     D9753_00415  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sdd01008]     D9753_00415 Polyketide biosynthesis proteins [BR:sdd01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     D9753_00415 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AYN37714 UniProt:  A0A3G2J6A9 LinkDB All DBs Position 21697..21915 Genome browser AA seq 72 aa AA seqDB search MLADPGSETTHLVVINEELQYSIWRADAGLPPGWTAEGTSGTREACLAHIDAVWTDMRPL SVRRAMEPTPSA NT seq 219 nt NT seq  +upstreamnt  +downstreamnt gtgcttgctgatccggggtcggagacgacccatctcgtggtcatcaacgaagagttgcag tactcgatctggcgtgccgacgccggactcccgcccggttggaccgccgagggcacctcg ggcacgcgcgaggcgtgcctggcgcacatcgacgccgtctggaccgacatgcggcccctg agcgtgcgccgggccatggaaccgactccttccgcctga

DBGET integrated database retrieval system