Streptomyces dangxiongensis: D9753_11205 Help Entry D9753_11205       CDS       T08044                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sdd  Streptomyces dangxiongensis Pathway sdd00261   Monobactam biosynthesis sdd01100   Metabolic pathways sdd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sdd00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     D9753_11205  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sdd01008]     D9753_11205 Polyketide biosynthesis proteins [BR:sdd01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     D9753_11205 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DUF2278 Motif Other DBs NCBI-ProteinID:  AYN39391 UniProt:  A0A3G2JCR4 LinkDB All DBs Position complement(2545896..2546105) Genome browser AA seq 69 aa AA seqDB search MSNPFEDEAGRYLVLVNDEGQHSLWPGFAEIPAGWEVAHPEDSRQACLDYIEKNWTDMRP ASLIRQMAG NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgtccaatccgttcgaggacgaagcgggcaggtacctggtactcgtcaacgacgagggc cagcactcgctgtggcccggtttcgccgagatccccgcgggctgggaagtggcccatccg gaggactccaggcaggcctgcctggactacatcgagaagaactggaccgacatgcgtccc gcgagcctgatccgtcagatggcgggatga

DBGET integrated database retrieval system