Streptomyces dangxiongensis: D9753_34930 Help Entry D9753_34930       CDS       T08044                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sdd  Streptomyces dangxiongensis Pathway sdd00261   Monobactam biosynthesis sdd01100   Metabolic pathways sdd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sdd00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     D9753_34930  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sdd01008]     D9753_34930 Polyketide biosynthesis proteins [BR:sdd01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     D9753_34930 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AYN43226 UniProt:  A0A3G2JL90 LinkDB All DBs Position 7825398..7825610 Genome browser AA seq 70 aa AA seqDB search MDNPFEQPDARYLVLVNDAAQYSLWPSRAAVPAGWSVALAAASRQACLDHVEAHRPDPRP RSVDGAAHTG NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atggacaacccgttcgagcagcccgacgcgcggtacctcgtcctggtgaacgacgcagcg cagtactcgctgtggccgagccgtgccgccgtaccggcgggatggtccgtggccctggcg gccgcgagccggcaggcctgcctcgatcatgtcgaggcacaccggccggacccccgcccc aggagcgtggacggggccgcgcacaccggctga

DBGET integrated database retrieval system