Streptomyces deccanensis: L3078_02380 Help Entry L3078_02380       CDS       T08215                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sdec  Streptomyces deccanensis Pathway sdec00261   Monobactam biosynthesis sdec01100   Metabolic pathways sdec01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sdec00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     L3078_02380  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sdec01008]     L3078_02380 Polyketide biosynthesis proteins [BR:sdec01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     L3078_02380 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ULR48217 LinkDB All DBs Position 518358..518567 Genome browser AA seq 69 aa AA seqDB search MSNPFEDPEGTYLVLVNDENQHSLWPDFVDVPAGWRVVHGPDSRQACVEHVETHWTDMRP RSLAESMDG NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgagcaacccgttcgaggaccccgagggcacctacctggtgctggtcaacgacgagaac cagcacagcttgtggccggatttcgtggacgtgccggccggctggcgggtggtccacgga cccgactcccggcaggcctgcgtggagcacgtcgagacccactggacggacatgcggccg cgcagtctggccgagtcgatggacggctga

DBGET integrated database retrieval system