Streptomyces deccanensis: L3078_05855 Help Entry L3078_05855       CDS       T08215                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sdec  Streptomyces deccanensis Pathway sdec00261   Monobactam biosynthesis sdec01100   Metabolic pathways sdec01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sdec00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     L3078_05855  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sdec01008]     L3078_05855 Polyketide biosynthesis proteins [BR:sdec01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     L3078_05855 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ULR48831 LinkDB All DBs Position complement(1278906..1279115) Genome browser AA seq 69 aa AA seqDB search MTNPFENPDGTYRVLVNDEGQHSLWPDSVAVPAGWTTAYGPDTRPACLDHIEREWTDLRP KSLIDAMNA NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgaccaaccccttcgagaaccccgacggcacctaccgggtcctggtcaacgacgagggc cagcactccctgtggcccgactccgtggccgtacccgccggctggacgaccgcctacggc ccggacacccgccccgcctgcctcgaccacatcgagcgcgagtggaccgacctgcgaccc aagagcctcatcgacgccatgaacgcctga

DBGET integrated database retrieval system