Sphingomonas daechungensis: H9L15_13610 Help Entry H9L15_13610       CDS       T07072                                  Name (GenBank) hypothetical protein   KO K00640   serine O-acetyltransferase [EC:2.3.1.30] Organism sdh  Sphingomonas daechungensis Pathway sdh00270   Cysteine and methionine metabolism sdh00543   Exopolysaccharide biosynthesis sdh00920   Sulfur metabolism sdh01100   Metabolic pathways sdh01110   Biosynthesis of secondary metabolites sdh01120   Microbial metabolism in diverse environments sdh01200   Carbon metabolism sdh01230   Biosynthesis of amino acids Module sdh_M00021   Cysteine biosynthesis, serine => cysteine Brite KEGG Orthology (KO) [BR:sdh00001]  09100 Metabolism   09102 Energy metabolism    00920 Sulfur metabolism     H9L15_13610   09105 Amino acid metabolism    00270 Cysteine and methionine metabolism     H9L15_13610   09107 Glycan biosynthesis and metabolism    00543 Exopolysaccharide biosynthesis     H9L15_13610 Enzymes [BR:sdh01000]  2. Transferases   2.3  Acyltransferases    2.3.1  Transferring groups other than aminoacyl groups     2.3.1.30  serine O-acetyltransferase      H9L15_13610 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hexapep Hexapep_2 DUF4140 WD40_alt DUF3375 bZIP_2 DUF1192 Motif Other DBs NCBI-ProteinID:  QNP44501 LinkDB All DBs Position complement(2503487..2503813) Genome browser AA seq 108 aa AA seqDB search MRDGVVIGSGAQVLGPIEVGAGAKIGANSVVTKDVPSGATVVGIPARPVPIDTVHYSPGF VAYGTPCGEDCDPGRARLNELEDEIAELRKEVAALKAARQPAPRAKSA NT seq 327 nt NT seq  +upstreamnt  +downstreamnt attcgtgacggcgtggtcattggctcgggcgcgcaagtgctcggaccgatcgaggtcggc gcgggcgcaaaaatcggcgccaactccgtggtcaccaaggacgttccttcgggggcgacc gtcgttggcattcccgcgcggccggtgccgatcgacacggtgcattatagccccggcttc gtcgcctacggtactccgtgcggagaggattgcgatccgggccgtgcccgactcaacgag cttgaggacgagatcgccgagctgcgcaaagaggtcgccgcgctgaaagctgcgcgccag cccgcgccaagggccaaaagcgcttga

DBGET integrated database retrieval system