Selenomonas dianae: QU667_00760 Help Entry QU667_00760       CDS       T09257                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism sdia  Selenomonas dianae Pathway sdia00020   Citrate cycle (TCA cycle) sdia01100   Metabolic pathways sdia01110   Biosynthesis of secondary metabolites sdia01120   Microbial metabolism in diverse environments sdia01200   Carbon metabolism sdia01210   2-Oxocarboxylic acid metabolism Module sdia_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:sdia00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     QU667_00760 Enzymes [BR:sdia01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      QU667_00760 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_9 Fer4_10 Fer4_7 Fer4_21 Fer4_2 Fer4_6 Fer4_17 Fer4_16 Fer4_8 Fer4_4 Fer4_15 Fer4_22 Fer4_13 Fer4_3 Motif Other DBs NCBI-ProteinID:  WLD82548 LinkDB All DBs Position complement(164019..164213) Genome browser AA seq 64 aa AA seqDB search MKGELYIKEKRCKGCGICAAFCPKKVLEVSLLGKITPARPEDCIACGQCEMRCPDFAIFV ERRA NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgaagggtgagctgtatatcaaggaaaagcggtgcaagggctgcgggatatgtgcagcg ttctgtccgaagaaggtgcttgaggtgagtctgctcggcaagatcacgcccgcccgcccc gaggactgcatcgcgtgcgggcagtgcgagatgcgctgtcccgattttgcgatattcgta gagaggagggcgtga

DBGET integrated database retrieval system