Streptomyces drozdowiczii: NEH16_02030 Help Entry NEH16_02030       CDS       T09042                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sdrz  Streptomyces drozdowiczii Pathway sdrz00261   Monobactam biosynthesis sdrz01100   Metabolic pathways sdrz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sdrz00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     NEH16_02030  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sdrz01008]     NEH16_02030 Polyketide biosynthesis proteins [BR:sdrz01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     NEH16_02030 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  UZK53061 LinkDB All DBs Position complement(433703..433918) Genome browser AA seq 71 aa AA seqDB search MTNPFDDQDGTFLVLVNDENQHSLWPQFADVPAGWTVAHGPDTHAACLEHIERNWTDMRP KSLADAMDTRR NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgaccaaccccttcgacgaccaggacggcaccttcctcgtcctcgtcaacgacgagaac cagcactcgctctggccgcagttcgccgacgtccccgccggctggaccgtcgcccacggc ccggacacccacgccgcctgcctggagcacatcgagcggaactggaccgacatgcggccc aagagcctcgccgacgccatggacacccggcggtag

DBGET integrated database retrieval system