Streptomyces davaonensis: BN159_5874 Help Entry BN159_5874        CDS       T02518                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism sdv  Streptomyces davaonensis Pathway sdv00261   Monobactam biosynthesis sdv01100   Metabolic pathways sdv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sdv00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BN159_5874  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sdv01008]     BN159_5874 Polyketide biosynthesis proteins [BR:sdv01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BN159_5874 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DUF2278 Motif Other DBs NCBI-ProteinID:  CCK30253 UniProt:  K4RA61 LinkDB All DBs Position 6574243..6574452 Genome browser AA seq 69 aa AA seqDB search MSNPFEDNDARYLVLRNDEGQHSLWPAFAAVPDGWTTVHGEAGRQECLDYVEEHWTDLRP ASLVRAADV NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgagcaaccccttcgaggacaacgacgcccgctatctggtcctgcgcaacgacgagggc cagcactccctgtggccggcgttcgccgccgtccccgacggctggacgaccgtccacggg gaggccgggcggcaggagtgcctggactacgtcgaggagcactggaccgacctgcgtccg gcgagcctggtccgggccgccgatgtctga

DBGET integrated database retrieval system