Streptomyces decoyicus: K7C20_27870 Help Entry K7C20_27870       CDS       T07553                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sdw  Streptomyces decoyicus Pathway sdw00261   Monobactam biosynthesis sdw01100   Metabolic pathways sdw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sdw00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     K7C20_27870  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sdw01008]     K7C20_27870 Polyketide biosynthesis proteins [BR:sdw01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     K7C20_27870 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QZY18596 LinkDB All DBs Position 6328582..6328797 Genome browser AA seq 71 aa AA seqDB search MTNPFENPEGRYLVLVNDEDQYSLWPAFAQVPAGWRVANEEAGHEESLAYISEHWTDMRP RSVVEAMGSTA NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgaccaatccattcgagaaccccgaaggccgctacctggtcctggtcaacgacgaggac cagtactccctgtggccggccttcgcacaggtgccggccggctggcgggtggccaacgag gaggcggggcacgaagagagcctcgcctacatctccgaacactggaccgacatgcggccg cgcagtgtcgtcgaggcgatgggctcgacggcatga

DBGET integrated database retrieval system