Streptomyces dengpaensis: C4B68_04555 Help Entry C4B68_04555       CDS       T06611                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sdx  Streptomyces dengpaensis Pathway sdx00261   Monobactam biosynthesis sdx01100   Metabolic pathways sdx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sdx00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     C4B68_04555  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sdx01008]     C4B68_04555 Polyketide biosynthesis proteins [BR:sdx01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     C4B68_04555 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AVH60961 UniProt:  A0A2L2MWS8 LinkDB All DBs Position 969756..969944 Genome browser AA seq 62 aa AA seqDB search MSREAGPFDPGPDGKDTHLVLENAHGQLSLWPAWRAVPPGWSARFGPAPHDACARQVDAA RG NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atgagccgtgaagccggtccgttcgatccgggccccgacggcaaggacacccacctcgtg ctggagaacgcccacgggcagctgtccctgtggcccgcctggcgcgccgtaccgccgggt tggagcgcccgcttcggccccgccccacacgacgcctgcgcgcgccaggtggatgcggcc cggggatga

DBGET integrated database retrieval system