Shigella dysenteriae Sd197: SDY_3241 Help Entry SDY_3241          CDS       T00306                                  Symbol ygiG Name (GenBank) putative kinase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism sdy  Shigella dysenteriae Sd197 Pathway sdy00790   Folate biosynthesis sdy01100   Metabolic pathways sdy01240   Biosynthesis of cofactors Module sdy_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:sdy00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     SDY_3241 (ygiG) Enzymes [BR:sdy01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      SDY_3241 (ygiG)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      SDY_3241 (ygiG)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      SDY_3241 (ygiG) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB DUF2866 Motif Other DBs NCBI-ProteinID:  ABB63248 ShiBASE_China:  SDY3241 UniProt:  Q32BQ7 LinkDB All DBs Position complement(3004319..3004690) Genome browser AA seq 123 aa AA seqDB search MMDIVFIEQLSVITTIGVYDWEQTIEQKLVFDIEMAWDNRKAAKSDDVADCLSYADIAET VVSHVEGARFALVERVAEEVAELLLARFNSPWVRIKLSKPGAVARAANVGVIIERGNNLK ENN NT seq 372 nt NT seq  +upstreamnt  +downstreamnt gtgatggatattgtatttatagagcaactttcggtaatcaccactattggtgtttacgac tgggaacagaccatcgaacagaagttagtgttcgatatcgaaatggcgtgggataaccgt aaagcggcgaaaagtgatgatgtggcggattgcctcagctacgctgacattgcagaaacg gtggtcagccacgtcgagggggcacgttttgcgctggtggagcgcgtggcggaagaggtg gcggagctgctgttagcacgcttcaactcgccgtgggtgcgtatcaaactcagcaagcca ggcgcagtggcgcgggcggcgaatgttggcgtaatcattgagcgtggcaataatctgaaa gaaaataattaa

DBGET integrated database retrieval system