Pseudomonas aeruginosa B18: B18_24140 Help Entry B18_24140         CDS       T06681                                  Name (GenBank) MbtH protein   KO K05375   MbtH protein Organism sech  Pseudomonas aeruginosa B18 Pathway sech00261   Monobactam biosynthesis sech01100   Metabolic pathways sech01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sech00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     B18_24140  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sech01008]     B18_24140 Polyketide biosynthesis proteins [BR:sech01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     B18_24140 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QLD77083 LinkDB All DBs Position complement(5255968..5256186) Genome browser AA seq 72 aa AA seqDB search MTSVFDRDDIQFQVVVNHEEQYSIWPEYKEIPQGWRAAGKSGLKKDCLAYIEEVWTDMRP LSLRQHMDKAAG NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgacttcagtgttcgaccgtgacgacatccagttccaggtagtggtcaaccatgaggag cagtattccatctggccggaatacaaggagattccccagggctggcgggcggccggcaag agcggcctgaagaaggactgcctggcctacatcgaggaagtctggaccgacatgcgcccg ctgagcctgcgccagcacatggacaaggcggccggctga

DBGET integrated database retrieval system