Sedimentibacter sp. zth1: JYG23_04920 Help Entry JYG23_04920       CDS       T07110                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism sedz  Sedimentibacter sp. zth1 Pathway sedz00020   Citrate cycle (TCA cycle) sedz01100   Metabolic pathways sedz01110   Biosynthesis of secondary metabolites sedz01120   Microbial metabolism in diverse environments sedz01200   Carbon metabolism sedz01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:sedz00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     JYG23_04920 Enzymes [BR:sedz01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      JYG23_04920 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_2 Fer4_7 Fer4_9 Fer4_6 Fer4_21 Fer4_10 Fer4_16 Fer4_4 Fer4_8 Fer4_17 Fer4_3 Fer4_22 Fer4_13 Fer4_15 ETF_QO Motif Other DBs NCBI-ProteinID:  QSX06793 UniProt:  A0A974XBK4 LinkDB All DBs Position complement(1000596..1000799) Genome browser AA seq 67 aa AA seqDB search MANKNSLTINKEWCKGCGICAAFCPKQVLAIEQEKAVIVNIDNCIKCGLCELRCPDSAIY LGGSKDE NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atggctaataaaaatagtctaactattaacaaagaatggtgtaagggttgtggaatatgc gcagcattttgtccaaaacaagttcttgctatagagcaagaaaaagctgttattgtaaat atagataactgtattaaatgtggattatgtgaattaagatgtccagatagcgcaatatat ttaggaggtagtaaagatgagtaa

DBGET integrated database retrieval system