Selenomonas sp. oral taxon 478: ADJ74_05135 Help Entry ADJ74_05135       CDS       T04017                                  Name (GenBank) 4Fe-4S ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism sele  Selenomonas sp. oral taxon 478 Pathway sele00020   Citrate cycle (TCA cycle) sele01100   Metabolic pathways sele01110   Biosynthesis of secondary metabolites sele01120   Microbial metabolism in diverse environments sele01200   Carbon metabolism sele01210   2-Oxocarboxylic acid metabolism Module sele_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:sele00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     ADJ74_05135 Enzymes [BR:sele01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      ADJ74_05135 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_9 Fer4_10 Fer4_7 Fer4_2 Fer4_6 Fer4_21 Fer4_17 Fer4_16 Fer4_4 Fer4_8 Fer4_15 Fer4_13 Fer4_22 Fer4_3 Motif Other DBs NCBI-ProteinID:  AKT53871 UniProt:  A0A0K1FHG1 LinkDB All DBs Position 1:complement(1095565..1095759) Genome browser AA seq 64 aa AA seqDB search MKGELYIKEKRCKGCGICAAFCPKKVLEVSLLGKIVPVRPEDCIACGQCEMRCPDFAIFV ERRA NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgaaaggtgagctgtatatcaaggaaaagcggtgcaagggctgcggcatctgcgcggca ttctgcccgaagaaggtgctcgaggtgagtctgctcggcaagattgtgcccgtgcgcccc gaggactgcatcgcgtgcgggcagtgcgagatgcgctgtcccgattttgcgattttcgtg gagaggagggcgtag

DBGET integrated database retrieval system