Selenomonas sp. oral taxon 920: BCS37_01190 Help Entry BCS37_01190       CDS       T04818                                  Name (GenBank) 4Fe-4S ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism selt  Selenomonas sp. oral taxon 920 Pathway selt00020   Citrate cycle (TCA cycle) selt01100   Metabolic pathways selt01110   Biosynthesis of secondary metabolites selt01120   Microbial metabolism in diverse environments selt01200   Carbon metabolism selt01210   2-Oxocarboxylic acid metabolism Module selt_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:selt00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     BCS37_01190 Enzymes [BR:selt01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      BCS37_01190 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_9 Fer4_7 Fer4_10 Fer4_2 Fer4_6 Fer4_21 Fer4_16 Fer4_17 Fer4_4 Fer4_8 Fer4_15 Fer4_13 Fer4_22 Fer4_3 Motif Other DBs NCBI-ProteinID:  AOH47143 UniProt:  A0A1B3X1Q7 LinkDB All DBs Position complement(262788..262988) Genome browser AA seq 66 aa AA seqDB search MKGELYIKEKRCKGCGICAAFCPKQVLEVSLLGKIVPVRPEDCIACGQCEMRCPDFAIFV ERRESK NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atgaagggtgagctgtatatcaaggaaaagcggtgcaagggctgcggcatctgcgccgcg ttctgcccgaagcaggtgctcgaggtgagcctgctcggcaagatcgtacccgtccgcccc gaggactgtatcgcgtgcgggcagtgcgagatgcgctgtcccgattttgcgatattcgtg gagcggagggagagcaaatga

DBGET integrated database retrieval system