Selenomonas sp. oral taxon 920: BCS37_03840 Help Entry BCS37_03840       CDS       T04818                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism selt  Selenomonas sp. oral taxon 920 Pathway selt00790   Folate biosynthesis selt01100   Metabolic pathways selt01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:selt00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     BCS37_03840 Enzymes [BR:selt01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      BCS37_03840  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      BCS37_03840  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      BCS37_03840 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AOH47627 UniProt:  A0A1B3X359 LinkDB All DBs Position 827773..828147 Genome browser AA seq 124 aa AA seqDB search MDRIFLRGMRFMAAHGVLPHEQKVPQPFEVDVELGLDLHAAGESDDLAATVNYAAVCESV RDIIEGAPKRLIEALAEKIADDLLRGFDLLLWVCVTVHKPAAPINGIFSDVGVTILRRRK NTEC NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atggatcgaatctttttgcgcgggatgcggtttatggctgcccacggtgtgctcccccat gagcagaaagtgccgcagccgtttgaggtggatgtggagcttggacttgatctgcacgca gcaggggagagtgacgatcttgcggcaacggtgaactatgccgcagtctgcgagagcgta cgggatatcatcgaaggtgcgccaaagcgactgattgaagcactcgccgagaagattgcg gatgatctcctgcgaggcttcgatctgctgctttgggtatgtgttacggtgcataagccc gctgcaccgattaacggcatattctcggatgtcggcgtgacgatcctgcgccgcaggaaa aataccgaatgttga

DBGET integrated database retrieval system