Staphylococcus epidermidis ATCC 12228: SE_2268 Help Entry SE_2268           CDS       T00110                                  Name (GenBank) 7,8-dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism sep  Staphylococcus epidermidis ATCC 12228 Pathway sep00790   Folate biosynthesis sep01100   Metabolic pathways sep01240   Biosynthesis of cofactors Module sep_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:sep00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     SE_2268 Enzymes [BR:sep01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      SE_2268  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      SE_2268  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      SE_2268 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AAO05910 UniProt:  Q8CMT8 LinkDB All DBs Position complement(2341227..2341592) Genome browser AA seq 121 aa AA seqDB search MNDIIFLNGMRFYGYHGVLAAENDIGQIFVVDITLKVDLSYAGQSDDVKDTVNYGEVYKD VKSIVEGPRSCLIEHLAERIAKHINSHYNRVMETKVRITKENPPIPGHYDGVGIEIVREN D NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atgaacgacatcatctttcttaatggaatgcgtttttatggttatcatggagtattagct gcagaaaatgatattggacaaatttttgttgttgatattactttaaaggttgatcttagt tatgcaggtcaatcagatgatgtaaaagatactgtaaattatggagaggtttataaagat gtaaagtctattgttgaagggccacgttcatgcttaattgagcatctggctgaacgtatt gcaaaacatataaattcacactataatcgtgtaatggaaacgaaagttagaatcactaaa gaaaacccacctattcctggtcattacgatggtgttgggattgaaatagtgagggagaat gactaa

DBGET integrated database retrieval system