Serratia sp. FS14: L085_16420 Help Entry L085_16420        CDS       T03313                                  Name (GenBank) MbtH domain-containing protein   KO K05375   MbtH protein Organism serf  Serratia sp. FS14 Pathway serf00261   Monobactam biosynthesis serf01100   Metabolic pathways serf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:serf00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     L085_16420  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:serf01008]     L085_16420 Polyketide biosynthesis proteins [BR:serf01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     L085_16420 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AIA48701 LinkDB All DBs Position 3603726..3603950 Genome browser AA seq 74 aa AA seqDB search MTQEQQNPFDDESLRFSVLVNAQQQYSLWPQFADTPQGWRVLMGPASRGECIDYIETHWQ DMRPAALKAADAAR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgactcaggaacaacaaaacccgttcgatgacgaaagcctccgtttctccgtgctggtc aacgcgcagcagcagtattcgctgtggccgcagtttgccgatacgccgcaggggtggcgc gtgctgatggggccggcgtcgcgcggcgagtgcatcgactacatcgaaacgcactggcag gacatgcggccggcggcgctgaaagcggcggatgcggcgcgttaa

DBGET integrated database retrieval system