Saccharothrix espanaensis: BN6_32500 Help Entry BN6_32500         CDS       T02404                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism sesp  Saccharothrix espanaensis Pathway sesp00261   Monobactam biosynthesis sesp01100   Metabolic pathways sesp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sesp00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BN6_32500  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sesp01008]     BN6_32500 Polyketide biosynthesis proteins [BR:sesp01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BN6_32500 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  CCH30554 UniProt:  K0K126 LinkDB All DBs Position 3472110..3472337 Genome browser AA seq 75 aa AA seqDB search MTNPFDDQDGRFLVLVNDEGQHCLWPAFARVPAGWTVALEETTRDAALSFVEDNWTDMRP RSLREAHEATESKAS NT seq 228 nt NT seq  +upstreamnt  +downstreamnt gtgacgaacccctttgacgaccaggacggccggtttctcgtgctggtgaacgacgaaggc cagcactgcctgtggccggcgttcgcccgcgtgcccgccggctggaccgtggcactggag gagaccacgcgggacgcggcgctgtccttcgtggaggacaactggaccgacatgcgtccg cgcagcctccgcgaggcccacgaggccaccgagagcaaggcgagctga

DBGET integrated database retrieval system