Saccharothrix espanaensis: BN6_47950 Help Entry BN6_47950         CDS       T02404                                  Name (GenBank) putative MbtH-like protein   KO K05375   MbtH protein Organism sesp  Saccharothrix espanaensis Pathway sesp00261   Monobactam biosynthesis sesp01100   Metabolic pathways sesp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sesp00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BN6_47950  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sesp01008]     BN6_47950 Polyketide biosynthesis proteins [BR:sesp01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BN6_47950 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  CCH32070 UniProt:  K0JW82 LinkDB All DBs Position complement(5335013..5335204) Genome browser AA seq 63 aa AA seqDB search MGASTYRVVVNDAEQYSIWPAGADLPPGWADAGMTGSQDDCLARIDRVWVDLRPAGVRAR LAG NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atgggggcgtccacgtatcgcgtcgtggtcaacgacgcggagcagtactcgatctggccc gccggcgcggatctcccgcctggttgggccgacgccgggatgaccggctcgcaagacgac tgcctggcccgcatcgaccgcgtctgggtcgacctgcgcccggccggagtgcgtgcccgg ctcgccgggtag

DBGET integrated database retrieval system