Streptococcus equi subsp. equi 4047: SEQ_1126 Help Entry SEQ_1126          CDS       T00877                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism seu  Streptococcus equi subsp. equi 4047 Pathway seu00790   Folate biosynthesis seu01100   Metabolic pathways seu01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:seu00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     SEQ_1126 Enzymes [BR:seu01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      SEQ_1126  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      SEQ_1126  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      SEQ_1126 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  CAW93795 UniProt:  C0MA61 LinkDB All DBs Position 1115970..1116329 Genome browser AA seq 119 aa AA seqDB search MDKIRLEACRFYGYHGAFKEEQVLGQIFVVDLELSVDLMAASLSDCLEDTVHYGLVFETV RQIVEEKTFTLIERLAGAICQELFAQFLPIKAIKIAIKKENPPIAGHYQAVGIELERKR NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggataaaatcagattagaggcttgtcgcttttatggttatcatggtgcctttaaggag gagcaggtcttaggtcaaatttttgtagtggatttagaattatcagttgacttgatggct gcctctctttcagactgcctagaggatactgttcattatggtttagtttttgaaacagtc cgtcaaattgttgaggaaaagacctttacgcttatcgaacgtttggctggtgccatttgt caagagctatttgcccagtttttgcctattaaagcgattaaaatcgctattaaaaaagaa aatccaccgattgcaggccattatcaagctgtcggtattgaattggagagaaagagatga

DBGET integrated database retrieval system