Streptomyces pratensis: Sfla_0078 Help Entry Sfla_0078         CDS       T01647                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism sfa  Streptomyces pratensis Pathway sfa00261   Monobactam biosynthesis sfa01100   Metabolic pathways sfa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sfa00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Sfla_0078  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sfa01008]     Sfla_0078 Polyketide biosynthesis proteins [BR:sfa01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Sfla_0078 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ADW01547 UniProt:  A0A8D4B9Z0 LinkDB All DBs Position 83591..83842 Genome browser AA seq 83 aa AA seqDB search MSDHTESVYRVVLNDEEQYSIWQADRELPAGWRAEGTEGTKQECLEHIGRVWTDMRPASL RRRMESDAAGAAGGQGGRQSIPV NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgtccgaccacaccgaaagcgtctaccgcgtcgtgctcaacgacgaggagcagtactcg atctggcaggccgaccgcgaactgcccgcgggctggcgggccgaagggaccgagggcacc aagcaggagtgcctggagcacatcggccgggtgtggacggacatgcgtcccgccagtctg cgccgccggatggagagcgatgccgccggggcggcgggcggtcagggcggacgacagagc atcccggtctga

DBGET integrated database retrieval system