Streptomyces pratensis: Sfla_1336 Help Entry Sfla_1336         CDS       T01647                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism sfa  Streptomyces pratensis Pathway sfa00261   Monobactam biosynthesis sfa01100   Metabolic pathways sfa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sfa00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Sfla_1336  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sfa01008]     Sfla_1336 Polyketide biosynthesis proteins [BR:sfa01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Sfla_1336 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ADW02778 UniProt:  A0A8D3WF86 LinkDB All DBs Position complement(1602837..1603088) Genome browser AA seq 83 aa AA seqDB search MENVRTRGGTVVTNPFDDESGRFVALVNDEGQYSLWPAHIEVPGGWRADGPEGSRQECLD VIERAWTDMRPAGLVRASGADAG NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggagaacgtgagaacacgtggggggacagtcgtgaccaatcctttcgatgacgagtcg gggcgattcgtggcgctcgtgaacgacgaggggcagtactcgttgtggcccgcgcacatt gaggttccgggcggctggcgcgccgacggtccggaaggttcgcgtcaggaatgtctcgat gtgatcgagcgcgcctggaccgatatgcggcccgccggcctggtgcgggcgtcgggcgcc gacgcgggatag

DBGET integrated database retrieval system