Streptomyces fradiae: CP974_23610 Help Entry CP974_23610       CDS       T07648                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sfb  Streptomyces fradiae Pathway sfb00261   Monobactam biosynthesis sfb01100   Metabolic pathways sfb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sfb00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CP974_23610  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sfb01008]     CP974_23610 Polyketide biosynthesis proteins [BR:sfb01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CP974_23610 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QEV14477 LinkDB All DBs Position 5311223..5311432 Genome browser AA seq 69 aa AA seqDB search MSNPFEDENATYLVLVNDEGQHSLWPSFAEVPAGWETVLAEVPRAEAVEYVNTHWTDMRP KSLVEAMGA NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgagcaaccccttcgaggacgagaacgccacctacctggtcctggtcaacgacgagggc cagcactccctgtggccgtccttcgccgaggtgccggccgggtgggagaccgtcctcgcc gaggtcccgcgcgccgaggccgtcgagtacgtcaacacccactggaccgacatgcggccc aagagcctcgtcgaggcgatgggcgcctga

DBGET integrated database retrieval system