Streptomyces fradiae: CP974_28400 Help Entry CP974_28400       CDS       T07648                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sfb  Streptomyces fradiae Pathway sfb00261   Monobactam biosynthesis sfb01100   Metabolic pathways sfb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sfb00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CP974_28400  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sfb01008]     CP974_28400 Polyketide biosynthesis proteins [BR:sfb01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CP974_28400 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Dioxygenase_C Motif Other DBs NCBI-ProteinID:  QEV15233 LinkDB All DBs Position 6500346..6500564 Genome browser AA seq 72 aa AA seqDB search MSDSEQYRAEEYQVVLNDEEQYSVWRTDRPLPAGWRAEGTTGSRQECLDHIGRVWTDMRP LSLRRHLEPAGA NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgagcgacagcgagcagtaccgggccgaggagtaccaggtcgtcctcaacgacgaggag cagtactccgtctggcggaccgaccgcccgctgccggcgggctggcgcgccgagggcacg accgggtcgcgccaggagtgcctggaccacatcggccgcgtctggaccgacatgcgcccc ctgagcctgcgccgccacctggagccggccggcgcctga

DBGET integrated database retrieval system