Sinorhizobium fredii USDA 257: USDA257_c40860 Help Entry USDA257_c40860    CDS       T02188                                  Symbol folB Name (GenBank) dihydroneopterin aldolase FolB   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism sfd  Sinorhizobium fredii USDA 257 Pathway sfd00790   Folate biosynthesis sfd01100   Metabolic pathways sfd01240   Biosynthesis of cofactors Module sfd_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:sfd00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     USDA257_c40860 (folB) Enzymes [BR:sfd01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      USDA257_c40860 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      USDA257_c40860 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      USDA257_c40860 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AFL52628 UniProt:  I3X9S2 LinkDB All DBs Position complement(4261377..4261748) Genome browser AA seq 123 aa AA seqDB search MTATYTITLKNCAFFARHGVLDEEEFLGQRFFVDAELEVEQGTALAEDCIDDTVHYGIAF AEIERIVTGRRRYLIEALALEVAKTLCARFRQVRRAKVSIRKPNAPVPGVLDYVEVTVEH AAG NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgactgcgacctatacgatcaccctgaagaactgcgccttctttgcccgccatggcgtg cttgacgaggaggagttcctcggccaacgtttcttcgtggacgccgaactcgaggtggag cagggcacggcgctcgccgaagactgcatcgatgacaccgtgcattatggtatcgccttc gccgagatcgaaaggatcgttaccgggcgccggcgctacctgatcgaggcgctcgccctg gaagtcgccaagacgttgtgcgcccgtttccggcaggtacgccgagcgaaagtctccatc cgcaagcccaatgctccggtcccaggggtcctggactacgtggaagtcacggtcgagcat gccgcgggataa

DBGET integrated database retrieval system