Streptomyces ferrugineus: IM697_36905 Help Entry IM697_36905       CDS       T07428                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sfeu  Streptomyces ferrugineus Pathway sfeu00261   Monobactam biosynthesis sfeu01100   Metabolic pathways sfeu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sfeu00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     IM697_36905  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sfeu01008]     IM697_36905 Polyketide biosynthesis proteins [BR:sfeu01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     IM697_36905 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QOV35580 UniProt:  A0A7M2SGX7 LinkDB All DBs Position 8299924..8300130 Genome browser AA seq 68 aa AA seqDB search MTTNPFEDEDGTYLVLTNAQGQHSLWPDEIAVPDGWDVALTASSRAECLAFVEEHWTDIR PTRTGAHA NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgaccaccaaccccttcgaggacgaggacggcacctatctcgtgctcaccaacgcccag ggccagcactcgctgtggcccgacgagatcgccgtgccggacgggtgggacgtggcgctg accgcgagcagccgtgccgagtgcctcgccttcgtcgaggagcactggacggacatacgt cccacccgcacgggtgcacatgcctga

DBGET integrated database retrieval system