Streptomyces ferrugineus: IM697_42685 Help Entry IM697_42685       CDS       T07428                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sfeu  Streptomyces ferrugineus Pathway sfeu00261   Monobactam biosynthesis sfeu01100   Metabolic pathways sfeu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sfeu00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     IM697_42685  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sfeu01008]     IM697_42685 Polyketide biosynthesis proteins [BR:sfeu01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     IM697_42685 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QOV36613 UniProt:  A0A7M2SMB5 LinkDB All DBs Position 9594205..9594432 Genome browser AA seq 75 aa AA seqDB search MTADDTGRFHHVVINHERQYSVWPADSTIPAGWSPVGFTSTLDDCLAHVDQVWTDLRPQS LRNPCPGRPYGTGSS NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgacagcagacgacaccggccggttccatcatgtcgtgatcaaccacgagcgacagtac tcggtctggcctgcggacagcacgatcccggcgggctggtcccccgtcggcttcaccagc acgctggacgactgtctcgcccacgtcgaccaggtctggacggatctgcgcccgcagagc ttgcgcaatccctgccccggccggccctacggcaccgggagcagttga

DBGET integrated database retrieval system