Streptomyces microflavus: SFUL_2941 Help Entry SFUL_2941         CDS       T02650                                  Name (GenBank) MbtH protein   KO K05375   MbtH protein Organism sfi  Streptomyces microflavus Pathway sfi00261   Monobactam biosynthesis sfi01100   Metabolic pathways sfi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sfi00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SFUL_2941  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sfi01008]     SFUL_2941 Polyketide biosynthesis proteins [BR:sfi01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SFUL_2941 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AGK77880 UniProt:  N0CQG7 LinkDB All DBs Position complement(3341737..3341988) Genome browser AA seq 83 aa AA seqDB search MSDTTMYQVVVNDEEQHALWPARTAPPAGWRVEGFRGSEEECTAHVDRVWPDIRPLSLRR RLAERADGLAPAARSAASPAVGG NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgagtgacacgacgatgtaccaggtggtcgtcaacgatgaggagcagcacgcgctctgg cccgcccggacggcgccgccggccggctggcgggtggaggggttccggggctcggaggag gagtgcacggcgcatgtcgaccgggtgtggccggacatccggccgctctcgctgcgccgc cgcctcgcggagcgggccgacgggctggcaccggcggcccgctccgccgcctccccggcg gtgggcggatga

DBGET integrated database retrieval system