Streptomyces microflavus: SFUL_6920 Help Entry SFUL_6920         CDS       T02650                                  Name (GenBank) MbtH domain-containing protein   KO K05375   MbtH protein Organism sfi  Streptomyces microflavus Pathway sfi00261   Monobactam biosynthesis sfi01100   Metabolic pathways sfi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sfi00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SFUL_6920  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sfi01008]     SFUL_6920 Polyketide biosynthesis proteins [BR:sfi01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SFUL_6920 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DUF2278 Motif Other DBs NCBI-ProteinID:  AGK81797 UniProt:  N0D771 LinkDB All DBs Position 7789474..7789692 Genome browser AA seq 72 aa AA seqDB search MTNPFEDENGTYLVLVNHEGQHSLWPAFAEVPAGWTVVHPEDTRQACLDYVEENWTDLRP KSLTESMAADPA NT seq 219 nt NT seq  +upstreamnt  +downstreamnt gtgaccaacccgttcgaggacgagaacggcacctacctggtgctcgtcaaccacgagggg cagcactccctgtggcccgccttcgcggaggtgcccgccggctggaccgtggtgcacccg gaggacacccgccaggcctgcctcgactacgtggaggagaactggaccgacctgcggccc aagagtctcacggagagcatggcggccgatccggcatga

DBGET integrated database retrieval system